PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S04692.10
Common NameJCGZ_12350, LOC105639668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 293aa    MW: 32769.5 Da    PI: 6.3383
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S04692.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.22.1e-4171061100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+ r+kC+++Cv+apyfp +qp+kfanvh +FGasnv kll++l++++reda++sl+yeAear+rdPvyG+vg+i+ lq++l++l+++l  
  Jcr4S04692.10   7 PCAACKFRRQKCTQECVFAPYFPPDQPQKFANVHGVFGASNVAKLLNELSTTQREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKELQSDLYN 102
                    7********************************************************************************************999 PP

         DUF260  97 lkee 100
                    +k+e
  Jcr4S04692.10 103 AKKE 106
                    8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0776107IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-417104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSSPNSPCAA CKFRRQKCTQ ECVFAPYFPP DQPQKFANVH GVFGASNVAK LLNELSTTQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HRLKELQSDL YNAKKELAQY IGHQAMLPTL  120
QSPLYMPAQP SHLGNPSSLI QQGSFPIMGT PTGQLLVREN QQQHQQEVYE AQQLAAALAS  180
REQQQMFKVY ENQQKQQEIA RFNRGFNSSD SINTNNTTGF NQITVSAMSP SLALGTFDNT  240
TYHIQPEQMD QHHHLQAQLF LQSQQEEQQS QQTQQLQHQT SGSDEGGSVI PSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079181.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-81LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A067KJ760.0A0A067KJ76_JATCU; Uncharacterized protein
STRINGPOPTR_0007s11460.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-78ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]